PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011071735.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 293aa    MW: 33148.1 Da    PI: 4.8416
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011071735.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260114.76e-36101091100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rr+C+++C lap fpa+qpk f nvh+lFG++++++llk+l+++++++am+s+ ++A +r + PvyG++  i++l+ q++ +++el+
  XP_011071735.1  10 ACAACKYQRRRCTPECLLAPFFPADQPKMFLNVHRLFGVKHIQNLLKELDPDQKPMAMKSIKFHAAMRDKYPVYGCLVEIQQLTYQIQLAEEELQ 104
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                     ++ ++
  XP_011071735.1 105 AVLQQ 109
                     98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.0379110IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-3410106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MTLKSGTGQA CAACKYQRRR CTPECLLAPF FPADQPKMFL NVHRLFGVKH IQNLLKELDP  60
DQKPMAMKSI KFHAAMRDKY PVYGCLVEIQ QLTYQIQLAE EELQAVLQQL AYYRQQQHQQ  120
QDMSPTDDYL SQLQLGMAPP GNAGMPVVHQ DNPPQQYNVV TAVPVAPHAS YSNNANANYN  180
TNLDSKENND VDSLWFQQAY SYNSNNTNPN SMVIQSQLAT SEPMPIPQEA PQDYNEMHPF  240
FDNIDDRQSY IGSKEPYESS LESPLKDSRQ TVEQIAENEL KSAAACFSLT SVN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071735.10.0PREDICTED: LOB domain-containing protein 27
TrEMBLM1B0F51e-115M1B0F5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000342881e-115(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14492375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.15e-38LOB domain-containing protein 27